(data stored in ACNUC1104 zone)

EMBL: AP008957.TGT

AP008957.TGT         Location/Qualifiers
FT   CDS             384080..385342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="RER_03440"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="protein synonym:queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31052"
FT                   /db_xref="GOA:C0ZM75"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM75"
FT                   /protein_id="BAH31052.1"
FT                   /translation="MPAVDKRPESIFTIGTRLEDRLGRTGTIHTPHGDIATPSFVAVGT
FT                   KATVKAVLPESMKELGAQSLLANAYHLYLQPGPDIVDEAGGLGKFMNWDGPTFTDSGGF
FT                   QVMSLGVGFKKVLAMEAVGVQSDDVIAKGKERLATVDDEGVTFKSHLDGSKHRFTPEVS
FT                   MQIQHQLGADIMFAFDELTTLLNTRGYQERSVERTQAWAIRCINEHEKLTAERAEKPYQ
FT                   ALFGVIQGAQYEDLRRQACRGLESIEGENGYGFDGYGIGGALEKQNLGTIVRWCNEELP
FT                   ENKPRHMLGISEPDDFFVAIENGADTFDCVNPSRVARNAAIYVRSGRFNINTSRFRRDF
FT                   TPIDDECDCYTCANYTRAYIHHLFKAKEMLASTLCTIHNERFTVKLVDDIRASIEGGYF
FT                   HDFKADMLGKFYAAKTPAPQT"
     MPAVDKRPES IFTIGTRLED RLGRTGTIHT PHGDIATPSF VAVGTKATVK AVLPESMKEL        60
     GAQSLLANAY HLYLQPGPDI VDEAGGLGKF MNWDGPTFTD SGGFQVMSLG VGFKKVLAME       120
     AVGVQSDDVI AKGKERLATV DDEGVTFKSH LDGSKHRFTP EVSMQIQHQL GADIMFAFDE       180
     LTTLLNTRGY QERSVERTQA WAIRCINEHE KLTAERAEKP YQALFGVIQG AQYEDLRRQA       240
     CRGLESIEGE NGYGFDGYGI GGALEKQNLG TIVRWCNEEL PENKPRHMLG ISEPDDFFVA       300
     IENGADTFDC VNPSRVARNA AIYVRSGRFN INTSRFRRDF TPIDDECDCY TCANYTRAYI       360
     HHLFKAKEML ASTLCTIHNE RFTVKLVDDI RASIEGGYFH DFKADMLGKF YAAKTPAPQT       420
//

If you have problems or comments...

PBIL Back to PBIL home page