(data stored in ACNUC1104 zone)

EMBL: AP008957.YRBE1A

AP008957.YRBE1A      Location/Qualifiers
FT   CDS             complement(758496..759275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE1A"
FT                   /locus_tag="RER_06790"
FT                   /product="putative YrbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31387"
FT                   /db_xref="GOA:C0ZPQ9"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ9"
FT                   /protein_id="BAH31387.1"
FT                   /translation="MFSNLLSEIGLLFTFTVRVCVAAFTTLRHKRLAWREALDQMWFLA
FT                   HVTSVASALVMIPLGVGVALQIGSLADQIGAGSYSGAVVAFLIIGQAGPLVCALIIAGV
FT                   GGSAICADLGARTIREEIDALEVLGLPVLERLVVPRMIAIAVVCLLLNSIVLVIGLGAS
FT                   LFVHVLILDGNAQSFLRNLVQFSQPSDFVVSGIKAVAFALISGIVACYKGLTVKRGAQG
FT                   VGDAVNETVVLSFVLVFVANLAITQFYPLFVSVKGAY"
     MFSNLLSEIG LLFTFTVRVC VAAFTTLRHK RLAWREALDQ MWFLAHVTSV ASALVMIPLG        60
     VGVALQIGSL ADQIGAGSYS GAVVAFLIIG QAGPLVCALI IAGVGGSAIC ADLGARTIRE       120
     EIDALEVLGL PVLERLVVPR MIAIAVVCLL LNSIVLVIGL GASLFVHVLI LDGNAQSFLR       180
     NLVQFSQPSD FVVSGIKAVA FALISGIVAC YKGLTVKRGA QGVGDAVNET VVLSFVLVFV       240
     ANLAITQFYP LFVSVKGAY                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page