(data stored in ACNUC30630 zone)

EMBL: AP009044.PE10

AP009044.PE10        Location/Qualifiers
FT   CDS             complement(10105..11178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52971"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S8"
FT                   /protein_id="BAF52971.1"
FT                   /translation="MFMLAQRTLPIHITAPHLPVARVFHQIRATDADRTSLQRDLELSQ
FT                   AGITRHVSALIDAGLVEETRVDSGARSGRPRTKLGIDGRHLTAWGVHIGLRSTDFAVCD
FT                   LAGRVIRYERVDHEVSHSTPSETLNFVAHRLQTLSAGLPEPRNVGVALSAHLSANGTVT
FT                   SEDYGWSEVEIGAHLPFPATIGSGVAAMAGSEIINAPLTQSTQSTLYFYAREMVSHAWI
FT                   FNGAVHRPNSGRTPTAFGNTNTLKDAFRRGLTPTTFSDLVQLSHTNPLARQILNERAHK
FT                   LADAVTTAVDVVDPEAVVFAGEAFTLDPETLRIVVTQLRANTGSQLRIQRADAHILRTA
FT                   AIQVALHPIRQDPLAFV"
     MFMLAQRTLP IHITAPHLPV ARVFHQIRAT DADRTSLQRD LELSQAGITR HVSALIDAGL        60
     VEETRVDSGA RSGRPRTKLG IDGRHLTAWG VHIGLRSTDF AVCDLAGRVI RYERVDHEVS       120
     HSTPSETLNF VAHRLQTLSA GLPEPRNVGV ALSAHLSANG TVTSEDYGWS EVEIGAHLPF       180
     PATIGSGVAA MAGSEIINAP LTQSTQSTLY FYAREMVSHA WIFNGAVHRP NSGRTPTAFG       240
     NTNTLKDAFR RGLTPTTFSD LVQLSHTNPL ARQILNERAH KLADAVTTAV DVVDPEAVVF       300
     AGEAFTLDPE TLRIVVTQLR ANTGSQLRIQ RADAHILRTA AIQVALHPIR QDPLAFV          357
//

If you have problems or comments...

PBIL Back to PBIL home page