(data stored in ACNUC30630 zone)

EMBL: AP009044.PE106

AP009044.PE106       Location/Qualifiers
FT   CDS             complement(118634..118942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53063"
FT                   /db_xref="GOA:A4QA20"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA20"
FT                   /protein_id="BAF53063.1"
FT                   /translation="MSPLQVADKTGMKKSAISNLLKPLLAESLIVQVTAENDRRSKVLS
FT                   LSEKGTTYIQKTATRQNALESEWFGTLTDIEQDLLESLLRKLLDSNRASKVRKNRSN"
     MSPLQVADKT GMKKSAISNL LKPLLAESLI VQVTAENDRR SKVLSLSEKG TTYIQKTATR        60
     QNALESEWFG TLTDIEQDLL ESLLRKLLDS NRASKVRKNR SN                          102
//

If you have problems or comments...

PBIL Back to PBIL home page