(data stored in ACNUC30630 zone)

EMBL: AP009044.PE108

AP009044.PE108       Location/Qualifiers
FT   CDS             119678..120154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53065"
FT                   /db_xref="GOA:A4QA22"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QA22"
FT                   /protein_id="BAF53065.1"
FT                   /translation="MIPGEYILSSESLTGNVGREAKTIEIINTGDRPVQIGSHFHFAEV
FT                   NPSISFDRSEGYGFRLDIPSGTAVRLEPGDARTVNLVAIGGDRIVAGFRDLVDGPLEDL
FT                   KVNVWEGREDDWRRSSAAGDAPQELPQVEAAERGRKLDEATDVGTEDTPEEGQN"
     MIPGEYILSS ESLTGNVGRE AKTIEIINTG DRPVQIGSHF HFAEVNPSIS FDRSEGYGFR        60
     LDIPSGTAVR LEPGDARTVN LVAIGGDRIV AGFRDLVDGP LEDLKVNVWE GREDDWRRSS       120
     AAGDAPQELP QVEAAERGRK LDEATDVGTE DTPEEGQN                               158
//

If you have problems or comments...

PBIL Back to PBIL home page