(data stored in ACNUC30630 zone)

EMBL: AP009044.PE11

AP009044.PE11        Location/Qualifiers
FT   CDS             complement(11261..11524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52972"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S9"
FT                   /protein_id="BAF52972.1"
FT                   /translation="MKGLSAENVLAIADEVCAEHGVVVRDFAALAAAAAVSTANFHGVR
FT                   VFGSAEAMAGKVSEMIRALKPLSGRNETFAAVTQRVLLEINK"
     MKGLSAENVL AIADEVCAEH GVVVRDFAAL AAAAAVSTAN FHGVRVFGSA EAMAGKVSEM        60
     IRALKPLSGR NETFAAVTQR VLLEINK                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page