(data stored in ACNUC30630 zone)

EMBL: AP009044.PE110

AP009044.PE110       Location/Qualifiers
FT   CDS             121892..122365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53067"
FT                   /db_xref="GOA:A4QA24"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QA24"
FT                   /protein_id="BAF53067.1"
FT                   /translation="MIITAIDTNIYDQPEFVEGRDVIGVRFEDLVLDKRIQRVALSGGE
FT                   ELGLRLNHGHPILREGDVLKADDKTVFVVEIIPTDVLVITPSDIHQMGFVAHSLGNRHL
FT                   PAQFSKPGELTEKAAMIVQYDHTVVSFLDDHDIEYQRTELVPPIPFRHSGHTH"
     MIITAIDTNI YDQPEFVEGR DVIGVRFEDL VLDKRIQRVA LSGGEELGLR LNHGHPILRE        60
     GDVLKADDKT VFVVEIIPTD VLVITPSDIH QMGFVAHSLG NRHLPAQFSK PGELTEKAAM       120
     IVQYDHTVVS FLDDHDIEYQ RTELVPPIPF RHSGHTH                                157
//

If you have problems or comments...

PBIL Back to PBIL home page