(data stored in ACNUC30630 zone)

EMBL: AP009044.PE117

AP009044.PE117       Location/Qualifiers
FT   CDS             130722..132131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53074"
FT                   /db_xref="GOA:A4QA31"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA31"
FT                   /protein_id="BAF53074.1"
FT                   /translation="MEATTIDDAIAKLIDIYDTSTKLAKETLDNEDYAAYADVVYPKLT
FT                   VDVLEWKPIDRTEPFGYVDRAGRYSAILSKPRVIERYLREQLERLTSNYPCKIYVSESD
FT                   IRIPPEYIRGAPSATEARRAGDVADIIPRPTLDEVHDAIIDGDWHAFNGPELPLFHFGP
FT                   QRFDIACARIEHYTGINVEHVQKYILFTNYAMHTTEFVHFAMSELTSEDSRYVGLSLPN
FT                   GQVIDRETATSLGTETLDLTSRFQMPRYDLITEAGDGITIINIGVGPSNAKTITDCLAV
FT                   LRPEAWVMIGHCAGMDARMRIGDLILGNAYQREDHILDKRISLGNPIPAIPEIQKALEA
FT                   SVDEIYGSDNSLMRTGTVLSTDDRNWEWHTPEDLWNWLKGSTAAAVDMESSTLATNGYR
FT                   YRIPYGTLLSVSDLPLHAVPKLPAQAQAFYSNSKEAHVMCAVRAMEYLAVDPERLRTRK
FT                   LRRTLGEVPFR"
     MEATTIDDAI AKLIDIYDTS TKLAKETLDN EDYAAYADVV YPKLTVDVLE WKPIDRTEPF        60
     GYVDRAGRYS AILSKPRVIE RYLREQLERL TSNYPCKIYV SESDIRIPPE YIRGAPSATE       120
     ARRAGDVADI IPRPTLDEVH DAIIDGDWHA FNGPELPLFH FGPQRFDIAC ARIEHYTGIN       180
     VEHVQKYILF TNYAMHTTEF VHFAMSELTS EDSRYVGLSL PNGQVIDRET ATSLGTETLD       240
     LTSRFQMPRY DLITEAGDGI TIINIGVGPS NAKTITDCLA VLRPEAWVMI GHCAGMDARM       300
     RIGDLILGNA YQREDHILDK RISLGNPIPA IPEIQKALEA SVDEIYGSDN SLMRTGTVLS       360
     TDDRNWEWHT PEDLWNWLKG STAAAVDMES STLATNGYRY RIPYGTLLSV SDLPLHAVPK       420
     LPAQAQAFYS NSKEAHVMCA VRAMEYLAVD PERLRTRKLR RTLGEVPFR                   469
//

If you have problems or comments...

PBIL Back to PBIL home page