(data stored in ACNUC30630 zone)

EMBL: AP009044.PE121

AP009044.PE121       Location/Qualifiers
FT   CDS             136868..138187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53078"
FT                   /db_xref="GOA:A4QA33"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA33"
FT                   /protein_id="BAF53078.1"
FT                   /translation="MIGFLGLLASLILLIVLTMRGMNLLIAAPLSALVLAVISGLPLFP
FT                   QLVGSDEDSFVSTYMAGFSGFVASWFLMFLLGAIFGKVMEDSKSAASVSAWLTKKFGAK
FT                   YALAAVIVACAVLTYGGVSLFIVGFTVFPIALSLFKLANYPRRFIPAALAFGSVTFTMT
FT                   SAGSPEIQNWIPMEYLGTTPYAGWEVSLIVASVMAVGGYFLLHYLVKRAISRGEEFESR
FT                   PGDPKEYDGPLPNPALSLLPLLTVLILSFIFHDSLGTSALIVALTGGVVLTWLLNHKYM
FT                   SSFWRAASEGTTGALLAIANTAAVVGFGAIARTTPAFQDAVDVMTSVPGDPLIGGAIAI
FT                   IVIVALTGSASGGLTIALPILGPQYMDAGVNPEALHRVATLSSGALDSLPHGGYTVTTI
FT                   RVICGETHKTAYSPVFWVTVVVPTVGVILAVALFSLGVGI"
     MIGFLGLLAS LILLIVLTMR GMNLLIAAPL SALVLAVISG LPLFPQLVGS DEDSFVSTYM        60
     AGFSGFVASW FLMFLLGAIF GKVMEDSKSA ASVSAWLTKK FGAKYALAAV IVACAVLTYG       120
     GVSLFIVGFT VFPIALSLFK LANYPRRFIP AALAFGSVTF TMTSAGSPEI QNWIPMEYLG       180
     TTPYAGWEVS LIVASVMAVG GYFLLHYLVK RAISRGEEFE SRPGDPKEYD GPLPNPALSL       240
     LPLLTVLILS FIFHDSLGTS ALIVALTGGV VLTWLLNHKY MSSFWRAASE GTTGALLAIA       300
     NTAAVVGFGA IARTTPAFQD AVDVMTSVPG DPLIGGAIAI IVIVALTGSA SGGLTIALPI       360
     LGPQYMDAGV NPEALHRVAT LSSGALDSLP HGGYTVTTIR VICGETHKTA YSPVFWVTVV       420
     VPTVGVILAV ALFSLGVGI                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page