(data stored in ACNUC30630 zone)

EMBL: AP009044.PE128

AP009044.PE128       Location/Qualifiers
FT   CDS             144249..144581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53085"
FT                   /db_xref="GOA:A4QA40"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA40"
FT                   /protein_id="BAF53085.1"
FT                   /translation="MTTPTSPLLPLASDGCGCCAPSTPSATVSAPAVAAATDATPEGPT
FT                   TYQVTGMTCGHCAGNVTEAVSALPQVDDVQVDLIAGGVSIVTVTGSVPLETVHRAIEEA
FT                   GYTVLS"
     MTTPTSPLLP LASDGCGCCA PSTPSATVSA PAVAAATDAT PEGPTTYQVT GMTCGHCAGN        60
     VTEAVSALPQ VDDVQVDLIA GGVSIVTVTG SVPLETVHRA IEEAGYTVLS                  110
//

If you have problems or comments...

PBIL Back to PBIL home page