(data stored in ACNUC30630 zone)

EMBL: AP009044.PE131

AP009044.PE131       Location/Qualifiers
FT   CDS             complement(147872..148357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53088"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA43"
FT                   /protein_id="BAF53088.1"
FT                   /translation="MAVIISRRSSYCPNFATAPINTGRCDHAEQGHRGQGGRGSEHVSG
FT                   ADQADASQWHIVATRAHVLPSLLGKGEQAFLGIQIRPQARDTANDFVHKALALPETLAL
FT                   YNVSGNEDYLVHVAVSDSTALQALIIDKFLALPQVAHCRTQLIFGDPWVAPLQHSPE"
     MAVIISRRSS YCPNFATAPI NTGRCDHAEQ GHRGQGGRGS EHVSGADQAD ASQWHIVATR        60
     AHVLPSLLGK GEQAFLGIQI RPQARDTAND FVHKALALPE TLALYNVSGN EDYLVHVAVS       120
     DSTALQALII DKFLALPQVA HCRTQLIFGD PWVAPLQHSP E                           161
//

If you have problems or comments...

PBIL Back to PBIL home page