(data stored in ACNUC30630 zone)

EMBL: AP009044.PE153

AP009044.PE153       Location/Qualifiers
FT   CDS             164347..165420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53109"
FT                   /db_xref="GOA:A4QA64"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA64"
FT                   /protein_id="BAF53109.1"
FT                   /translation="MYFPPDGAVDFMAVSSTHERRYGRAPQKKGWRTFLRPGWVFGVLA
FT                   IIAFSYVAFTFLAPWQLSRDSTIVERNEQIEAAFEVELVPAEEIFDAQGSIEPGKEWAR
FT                   VILQGHYLPEDEVLMRNRPVDSSPAFHALTPFQLNSGEIILVNRGFNPPLEGGVPPMDT
FT                   APAGEQSIVGHARFTEQTPMSPPIEDQGYRQVYGINTAQISEVIGMDLAEDYVQLAEGQ
FT                   AGEINAIPVPMLDRGSHLSYAFQWIAFGIMAPLGLGYFIWAELKERRRVRREEAELADG
FT                   SASSQQTGDSQDEETDSDPVGALRTIHPENDTQGLAHAQATTSASSGARARMLHDRYGD
FT                   SQPNHSRKFTNRRHERF"
     MYFPPDGAVD FMAVSSTHER RYGRAPQKKG WRTFLRPGWV FGVLAIIAFS YVAFTFLAPW        60
     QLSRDSTIVE RNEQIEAAFE VELVPAEEIF DAQGSIEPGK EWARVILQGH YLPEDEVLMR       120
     NRPVDSSPAF HALTPFQLNS GEIILVNRGF NPPLEGGVPP MDTAPAGEQS IVGHARFTEQ       180
     TPMSPPIEDQ GYRQVYGINT AQISEVIGMD LAEDYVQLAE GQAGEINAIP VPMLDRGSHL       240
     SYAFQWIAFG IMAPLGLGYF IWAELKERRR VRREEAELAD GSASSQQTGD SQDEETDSDP       300
     VGALRTIHPE NDTQGLAHAQ ATTSASSGAR ARMLHDRYGD SQPNHSRKFT NRRHERF          357
//

If you have problems or comments...

PBIL Back to PBIL home page