(data stored in ACNUC30630 zone)

EMBL: AP009044.PE161

AP009044.PE161       Location/Qualifiers
FT   CDS             complement(171947..172573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53117"
FT                   /db_xref="GOA:A4QA70"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA70"
FT                   /protein_id="BAF53117.1"
FT                   /translation="MVSGLLSAIGLFLATNIDDIIVLSLFFARGAGQKGATARILVGQY
FT                   LGFVGILGAAVLVTLGAEAFLPEQAIPYFGLIPLLLGLWAAWQAWRSDDDDDDAGKVAG
FT                   KKVGILTVAGVTFANGGDNIGVYVPVFLNVGTATVITYCVVFLVLVAVLVLLAKFVATR
FT                   PPIAEVLERWEHVLFPIVLIGLGIFILVGGGAFGLNRHGFLAAFQ"
     MVSGLLSAIG LFLATNIDDI IVLSLFFARG AGQKGATARI LVGQYLGFVG ILGAAVLVTL        60
     GAEAFLPEQA IPYFGLIPLL LGLWAAWQAW RSDDDDDDAG KVAGKKVGIL TVAGVTFANG       120
     GDNIGVYVPV FLNVGTATVI TYCVVFLVLV AVLVLLAKFV ATRPPIAEVL ERWEHVLFPI       180
     VLIGLGIFIL VGGGAFGLNR HGFLAAFQ                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page