(data stored in ACNUC30630 zone)

EMBL: AP009044.PE165

AP009044.PE165       Location/Qualifiers
FT   CDS             complement(175421..176038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53121"
FT                   /db_xref="GOA:A4QA74"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA74"
FT                   /protein_id="BAF53121.1"
FT                   /translation="MALIGYMRVSKSDGSQTTDLQRDALIAAGVDPGHLYEDRASGKQE
FT                   DRPHLDACLKALRPGDTLLVWKLDRLGRNLWHLVNIVHDLTAREVGLKVLTGQGAAIDT
FT                   TSAQGKLVFGIFAALAEFERELISERTKAGLESARARGRKGGRPFKMTPAKVRLAMAAM
FT                   GQPETSVAALCKELGITRQTLYRHVSPTGELREDGRKLLSGS"
     MALIGYMRVS KSDGSQTTDL QRDALIAAGV DPGHLYEDRA SGKQEDRPHL DACLKALRPG        60
     DTLLVWKLDR LGRNLWHLVN IVHDLTAREV GLKVLTGQGA AIDTTSAQGK LVFGIFAALA       120
     EFERELISER TKAGLESARA RGRKGGRPFK MTPAKVRLAM AAMGQPETSV AALCKELGIT       180
     RQTLYRHVSP TGELREDGRK LLSGS                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page