(data stored in ACNUC30630 zone)

EMBL: AP009044.PE17

AP009044.PE17        Location/Qualifiers
FT   CDS             complement(17786..18712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52978"
FT                   /db_xref="GOA:A4Q9T5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9T5"
FT                   /protein_id="BAF52978.1"
FT                   /translation="MESIQAYNFTQWRQIVASSFHNVRAAAPAPNFRATAHHKHVGDIE
FT                   LFDMITDPHTVIHTEGDGSFPLSTMCKFSLQLEGVATLVQDGRSCTMSPGDLALYTGKR
FT                   PYHLVFDEPQRSLVVYFPRSLLQLRDDQIDMITATPISRDEGLGKIIIPLFEQFARNLD
FT                   DLQGLHAQSLIRASLDLLVTVFAEHTERMNGELEDSSQLFRRATSYIDENLHDLDLAPG
FT                   TIADALYVSVRNLHAHFSSQGLTVSAYIRARRLNAIHADLGNPQMRDFTIQSISARHGL
FT                   VDASYVSKAFRAEYGESPRTYRTRTLT"
     MESIQAYNFT QWRQIVASSF HNVRAAAPAP NFRATAHHKH VGDIELFDMI TDPHTVIHTE        60
     GDGSFPLSTM CKFSLQLEGV ATLVQDGRSC TMSPGDLALY TGKRPYHLVF DEPQRSLVVY       120
     FPRSLLQLRD DQIDMITATP ISRDEGLGKI IIPLFEQFAR NLDDLQGLHA QSLIRASLDL       180
     LVTVFAEHTE RMNGELEDSS QLFRRATSYI DENLHDLDLA PGTIADALYV SVRNLHAHFS       240
     SQGLTVSAYI RARRLNAIHA DLGNPQMRDF TIQSISARHG LVDASYVSKA FRAEYGESPR       300
     TYRTRTLT                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page