(data stored in ACNUC30630 zone)

EMBL: AP009044.PE175

AP009044.PE175       Location/Qualifiers
FT   CDS             183403..184170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53130"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA83"
FT                   /protein_id="BAF53130.1"
FT                   /translation="MDTDDSAHMPDAVIKASRQPANIEIAHQVGEVIAHMLGDGQSVID
FT                   PTETIWTAEAAEDLRARIGDNPILGSDKGQWDKLDHQLDGAPRAVVLLAAELVFLREHA
FT                   LYVALPTTRLAHVERVLAHLDPPVAIKDPMATWLSRPVRTAGFDPGSWYNGALWRHLIW
FT                   AATFVRHWKELPEDKRETAKNNPWAFQQVMLASGTDRSDIRNALQFLAFPQAFEPISAA
FT                   SMKTEIRNGLAHLIGGATGSTPAAIDSDLLAIR"
     MDTDDSAHMP DAVIKASRQP ANIEIAHQVG EVIAHMLGDG QSVIDPTETI WTAEAAEDLR        60
     ARIGDNPILG SDKGQWDKLD HQLDGAPRAV VLLAAELVFL REHALYVALP TTRLAHVERV       120
     LAHLDPPVAI KDPMATWLSR PVRTAGFDPG SWYNGALWRH LIWAATFVRH WKELPEDKRE       180
     TAKNNPWAFQ QVMLASGTDR SDIRNALQFL AFPQAFEPIS AASMKTEIRN GLAHLIGGAT       240
     GSTPAAIDSD LLAIR                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page