(data stored in ACNUC30630 zone)

EMBL: AP009044.PE182

AP009044.PE182       Location/Qualifiers
FT   CDS             193058..194005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53137"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA90"
FT                   /protein_id="BAF53137.1"
FT                   /translation="MEHGVTVIKGTEFDVFPLNLGGNTFGWTSNREQTFAVLDAFVAAG
FT                   GNFVDTADSYSAWVEGNEGGESERELGAWIKERGADKLIIATKSGALEPVAGRSREATF
FT                   KAVEGSLERLGVESIDIFYYHYDDEAVSIDEQVAIANDLIAQGKIKHLALSNYSAERLA
FT                   EFFEKSVGTPAQPVALQPHYNLVSRKDYEENVQPLAEKHGVAVFPYFALAAGLLTGKYT
FT                   SKEDISGKARAGQLDRYASDEAFAVVTELRAVADELGVAPTTVALAWLVAHGVTAPIAS
FT                   VSKVEQLKDLMAVKDVELSAEQLARLDKVSEPFA"
     MEHGVTVIKG TEFDVFPLNL GGNTFGWTSN REQTFAVLDA FVAAGGNFVD TADSYSAWVE        60
     GNEGGESERE LGAWIKERGA DKLIIATKSG ALEPVAGRSR EATFKAVEGS LERLGVESID       120
     IFYYHYDDEA VSIDEQVAIA NDLIAQGKIK HLALSNYSAE RLAEFFEKSV GTPAQPVALQ       180
     PHYNLVSRKD YEENVQPLAE KHGVAVFPYF ALAAGLLTGK YTSKEDISGK ARAGQLDRYA       240
     SDEAFAVVTE LRAVADELGV APTTVALAWL VAHGVTAPIA SVSKVEQLKD LMAVKDVELS       300
     AEQLARLDKV SEPFA                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page