(data stored in ACNUC30630 zone)

EMBL: AP009044.PE183

AP009044.PE183       Location/Qualifiers
FT   CDS             194153..195769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53138"
FT                   /db_xref="GOA:A4QA91"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA91"
FT                   /protein_id="BAF53138.1"
FT                   /translation="MSSTTSKTSERQQPDAPTSKLGKWSDKFLNGVETLGNKLPTPFTL
FT                   FLILFLITALASSIMAWMNVSVIVPGSDEELFVKGLFTGEGLTWLTTNLGANYIGFPPL
FT                   LTVLPILLAVGVAERSGMLAALIRKLFGSAKKIVLPYAVGVIGVTASIMADAAFVVVPP
FT                   LAAMVFKAAGRHPVAGLLGSFAAVGAGYSTAIVPTSLDALFAGITNAVMETLPGIATTE
FT                   VNPVSNYYFNIASSIVLGLLCGFLIDKVLEPRMWRQDIATEYAESVEPISGTGDEEISA
FT                   TLTVQENRALAISMWTTLVTAIVVLVVVLIPGSPWRNEDGGFLPTSPLLSSVVFIVFLF
FT                   FMVMGLAYGMVVGTIKNMDDVVNMMGEAIKDMIGFLVLAFILGQFVALFNWTGIGTWTA
FT                   VQGAAGLEAIGLTGFPAIIAFIILASCLNLLIISGSAMWTLMAAVFVPMFALLGYEPSF
FT                   IQAAFRVGDSATQVITPLNPYMIVILGLLRRYEPDAGLGTLMSRLIPFVIPFWLAWATL
FT                   LAIWFYADLPLGPGSAIFLEG"
     MSSTTSKTSE RQQPDAPTSK LGKWSDKFLN GVETLGNKLP TPFTLFLILF LITALASSIM        60
     AWMNVSVIVP GSDEELFVKG LFTGEGLTWL TTNLGANYIG FPPLLTVLPI LLAVGVAERS       120
     GMLAALIRKL FGSAKKIVLP YAVGVIGVTA SIMADAAFVV VPPLAAMVFK AAGRHPVAGL       180
     LGSFAAVGAG YSTAIVPTSL DALFAGITNA VMETLPGIAT TEVNPVSNYY FNIASSIVLG       240
     LLCGFLIDKV LEPRMWRQDI ATEYAESVEP ISGTGDEEIS ATLTVQENRA LAISMWTTLV       300
     TAIVVLVVVL IPGSPWRNED GGFLPTSPLL SSVVFIVFLF FMVMGLAYGM VVGTIKNMDD       360
     VVNMMGEAIK DMIGFLVLAF ILGQFVALFN WTGIGTWTAV QGAAGLEAIG LTGFPAIIAF       420
     IILASCLNLL IISGSAMWTL MAAVFVPMFA LLGYEPSFIQ AAFRVGDSAT QVITPLNPYM       480
     IVILGLLRRY EPDAGLGTLM SRLIPFVIPF WLAWATLLAI WFYADLPLGP GSAIFLEG         538
//

If you have problems or comments...

PBIL Back to PBIL home page