(data stored in ACNUC30630 zone)

EMBL: AP009044.PE197

AP009044.PE197       Location/Qualifiers
FT   CDS             206006..207388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53151"
FT                   /db_xref="GOA:Q1JUZ0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JUZ0"
FT                   /protein_id="BAF53151.1"
FT                   /translation="MALVLGIDSSTQSCKALLVDAATGQVIDEGRASHPSGSEVDPRAW
FT                   IAALDQATEGLLERADAVSIAGQQHGMVALDENDEIVRPALLWNDTRSAQAALDLNEEI
FT                   GGDQAAVDATGSVYVASLTATKMRWMRDHEPENAARTASVMLPHDFLTWHLMGRGRKVT
FT                   DHGDASGTGYYSTRDRAWRTDLAAWALGHEVELPELLAPNAIAGTTPGGVKVAAGTGDN
FT                   AAAALGLDLQPGDVSVSIGTSGVAGMTVQNSVHDTSGLVTGFADATGAYFPLACTLNGA
FT                   PVLEFGRRILGVEWEEFDALALAAQPGSGGVTLQPYLEGERTPNRPAARGVLAGLNSAT
FT                   TREDFARATVEGLLLALDDAVTALVEATGVPVQRIQLIGGGARSQAVREIAPEIFGHEI
FT                   VVPEPAEYVALGAARQAAWALSGEATPPQWPTPGSDPHRAPKNTELSTRYAKLRAATQG
FT                   WY"
     MALVLGIDSS TQSCKALLVD AATGQVIDEG RASHPSGSEV DPRAWIAALD QATEGLLERA        60
     DAVSIAGQQH GMVALDENDE IVRPALLWND TRSAQAALDL NEEIGGDQAA VDATGSVYVA       120
     SLTATKMRWM RDHEPENAAR TASVMLPHDF LTWHLMGRGR KVTDHGDASG TGYYSTRDRA       180
     WRTDLAAWAL GHEVELPELL APNAIAGTTP GGVKVAAGTG DNAAAALGLD LQPGDVSVSI       240
     GTSGVAGMTV QNSVHDTSGL VTGFADATGA YFPLACTLNG APVLEFGRRI LGVEWEEFDA       300
     LALAAQPGSG GVTLQPYLEG ERTPNRPAAR GVLAGLNSAT TREDFARATV EGLLLALDDA       360
     VTALVEATGV PVQRIQLIGG GARSQAVREI APEIFGHEIV VPEPAEYVAL GAARQAAWAL       420
     SGEATPPQWP TPGSDPHRAP KNTELSTRYA KLRAATQGWY                             460
//

If you have problems or comments...

PBIL Back to PBIL home page