(data stored in ACNUC30630 zone)

EMBL: AP009044.PE198

AP009044.PE198       Location/Qualifiers
FT   CDS             complement(207385..208224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53152"
FT                   /db_xref="GOA:A4QAA5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAA5"
FT                   /protein_id="BAF53152.1"
FT                   /translation="MQVATTKKALIDALLHHKSVGLVPTMGALHSGHASLVKAARAEND
FT                   TVVASIFVNPLQFEALGDCDDYRNYPRQLDADLALLEEAGVDIVFAPDVEEMYPGGLPL
FT                   VWARTGSIGTKLEGASRPGHFDGVATVVAKLFNLVRPDRAYFGQKDAQQVAVIRRLVAD
FT                   LDIPVEIRPVPIIRSADGLAESSRNQRLSADQRAQALVLPQVLSGLQRRKAAGEALDIQ
FT                   GARDTLASADGVRLDHLEIVDPATLEPLEIDGLLTQPALVVAAIFVGPVRLIDNIEL"
     MQVATTKKAL IDALLHHKSV GLVPTMGALH SGHASLVKAA RAENDTVVAS IFVNPLQFEA        60
     LGDCDDYRNY PRQLDADLAL LEEAGVDIVF APDVEEMYPG GLPLVWARTG SIGTKLEGAS       120
     RPGHFDGVAT VVAKLFNLVR PDRAYFGQKD AQQVAVIRRL VADLDIPVEI RPVPIIRSAD       180
     GLAESSRNQR LSADQRAQAL VLPQVLSGLQ RRKAAGEALD IQGARDTLAS ADGVRLDHLE       240
     IVDPATLEPL EIDGLLTQPA LVVAAIFVGP VRLIDNIEL                              279
//

If you have problems or comments...

PBIL Back to PBIL home page