(data stored in ACNUC30630 zone)

EMBL: AP009044.PE206

AP009044.PE206       Location/Qualifiers
FT   CDS             213478..214038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53159"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB2"
FT                   /protein_id="BAF53159.1"
FT                   /translation="MTPQPLILPFGDKVPRIHESAWIAPNATIIGDVEIGPDASIFYGV
FT                   VLRGDVNKIAIGARTNVQDNCVLHVDGDAPCTLGDDVTVGHMALVHGATVGNGTLVGMK
FT                   SALLSGSHVGAGALIAAGAVVLEGQEIPAKALAAGVPAKVRRLLDDAQSQSFIPHAGRY
FT                   VETSKAQASIAEALSLDEVRVRG"
     MTPQPLILPF GDKVPRIHES AWIAPNATII GDVEIGPDAS IFYGVVLRGD VNKIAIGART        60
     NVQDNCVLHV DGDAPCTLGD DVTVGHMALV HGATVGNGTL VGMKSALLSG SHVGAGALIA       120
     AGAVVLEGQE IPAKALAAGV PAKVRRLLDD AQSQSFIPHA GRYVETSKAQ ASIAEALSLD       180
     EVRVRG                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page