(data stored in ACNUC30630 zone)

EMBL: AP009044.PE212

AP009044.PE212       Location/Qualifiers
FT   CDS             219500..221050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53165"
FT                   /db_xref="GOA:A4QAB8"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB8"
FT                   /protein_id="BAF53165.1"
FT                   /translation="MSNPSLEPLEPLEPIELSDGTEIEVPDVDPEPQAGNAQMEVPSLR
FT                   TYVFRGIIAIACLVIGFYESFVLLWQNLRIGVANYSLLVVLMAIVLFIGLDRKRARALN
FT                   IHDREVDYIIGVIAVLIAITIKSQLLPRFVDWETLLRLDMFALLFFAFGISGLVFGMRS
FT                   TFSFAPGWILLFGYNAVAHLIISVIFGGGFWGPVMANIIGLSLAVLVSSNRDLVQATYL
FT                   ALMTVLFGVIFAIIVWALTDGSKFLTLVPAVLATITVVLVSSRWRLGQWKIRRRQPTVE
FT                   KAGPALIAVVVATALLAWIPTPYVERVNNLPGLQMLAKPAPGVIAPIGWHIDDVQYYNW
FT                   ASRYFGPGSSLLRQTMTADHYNEAWDPDGLDRTVVVDTLQSAERFQQHAFGDETLYSTL
FT                   RGRKSDTVQVDLGYGVVGRAYTVLDETDFLTYTKLVFEWQTTNNTVEKISVIAVDDHRA
FT                   EAKFPELAPSVTRMFIQVVTILFRGNGVTIDTNTQLKDLDLVSQVGRQIVAEQQVGRS"
     MSNPSLEPLE PLEPIELSDG TEIEVPDVDP EPQAGNAQME VPSLRTYVFR GIIAIACLVI        60
     GFYESFVLLW QNLRIGVANY SLLVVLMAIV LFIGLDRKRA RALNIHDREV DYIIGVIAVL       120
     IAITIKSQLL PRFVDWETLL RLDMFALLFF AFGISGLVFG MRSTFSFAPG WILLFGYNAV       180
     AHLIISVIFG GGFWGPVMAN IIGLSLAVLV SSNRDLVQAT YLALMTVLFG VIFAIIVWAL       240
     TDGSKFLTLV PAVLATITVV LVSSRWRLGQ WKIRRRQPTV EKAGPALIAV VVATALLAWI       300
     PTPYVERVNN LPGLQMLAKP APGVIAPIGW HIDDVQYYNW ASRYFGPGSS LLRQTMTADH       360
     YNEAWDPDGL DRTVVVDTLQ SAERFQQHAF GDETLYSTLR GRKSDTVQVD LGYGVVGRAY       420
     TVLDETDFLT YTKLVFEWQT TNNTVEKISV IAVDDHRAEA KFPELAPSVT RMFIQVVTIL       480
     FRGNGVTIDT NTQLKDLDLV SQVGRQIVAE QQVGRS                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page