(data stored in ACNUC30630 zone)

EMBL: AP009044.PE216

AP009044.PE216       Location/Qualifiers
FT   CDS             complement(225357..226034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53169"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC2"
FT                   /protein_id="BAF53169.1"
FT                   /translation="MTVRRDIAALEESGQVVSIKGGVKLSEGISTPVPLDRASRLALEL
FT                   HRKEAIAREAADRVTDGMTIFLDAGTTLQALVPYLEPRQNLTVITNDLFVATTLFNYPH
FT                   IRTIQTGGTIDPEIGACQGHLAARSVEIFNFDIAFISSSGWSLNRGLTAPAEEKRLLKR
FT                   KVMEVSTTSTLLADTTKYGVISMVTVCPLDEIDAIITDWGLDSQTIERIHELGVNLTVA
FT                   QEI"
     MTVRRDIAAL EESGQVVSIK GGVKLSEGIS TPVPLDRASR LALELHRKEA IAREAADRVT        60
     DGMTIFLDAG TTLQALVPYL EPRQNLTVIT NDLFVATTLF NYPHIRTIQT GGTIDPEIGA       120
     CQGHLAARSV EIFNFDIAFI SSSGWSLNRG LTAPAEEKRL LKRKVMEVST TSTLLADTTK       180
     YGVISMVTVC PLDEIDAIIT DWGLDSQTIE RIHELGVNLT VAQEI                       225
//

If you have problems or comments...

PBIL Back to PBIL home page