(data stored in ACNUC30630 zone)

EMBL: AP009044.PE220

AP009044.PE220       Location/Qualifiers
FT   CDS             228948..229706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53173"
FT                   /db_xref="GOA:A4QAC6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC6"
FT                   /protein_id="BAF53173.1"
FT                   /translation="MIVLTIAIVLLASVLIGALLQRMTGLGVGLVTGPVLTSLLGPLAG
FT                   VTMVNGLSIINAVNNAWSVRKRTDWAKFRILAGALVLGSVPAVAVVYFLNGPWLLIFVG
FT                   AMVLLALGVSLFPTEKFALKQEAKLPMVIFGMIGGFMSTVAGIAGPSLTVYARLSRWDY
FT                   RDFVATLHPVLLVANTVSFLLKVILIGGLDFGGAPAWLWIGAVAMIFVGAWLGEIVNAK
FT                   VSTPMAKRIATLLAAAGAAVVLFRGIMELV"
     MIVLTIAIVL LASVLIGALL QRMTGLGVGL VTGPVLTSLL GPLAGVTMVN GLSIINAVNN        60
     AWSVRKRTDW AKFRILAGAL VLGSVPAVAV VYFLNGPWLL IFVGAMVLLA LGVSLFPTEK       120
     FALKQEAKLP MVIFGMIGGF MSTVAGIAGP SLTVYARLSR WDYRDFVATL HPVLLVANTV       180
     SFLLKVILIG GLDFGGAPAW LWIGAVAMIF VGAWLGEIVN AKVSTPMAKR IATLLAAAGA       240
     AVVLFRGIME LV                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page