(data stored in ACNUC30630 zone)

EMBL: AP009044.PE223

AP009044.PE223       Location/Qualifiers
FT   CDS             231472..231807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53176"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC9"
FT                   /protein_id="BAF53176.1"
FT                   /translation="MKTYPVLIAVAGLALAGCSSSAPGIWRATEPADAYLEIADDGTLS
FT                   GSDGCNRLFGGWEKDGSTITFGAIGMTEMYCEGVNDWLSQMHTATVTDATMTIFNEAGS
FT                   NIGELKR"
     MKTYPVLIAV AGLALAGCSS SAPGIWRATE PADAYLEIAD DGTLSGSDGC NRLFGGWEKD        60
     GSTITFGAIG MTEMYCEGVN DWLSQMHTAT VTDATMTIFN EAGSNIGELK R                111
//

If you have problems or comments...

PBIL Back to PBIL home page