(data stored in ACNUC30630 zone)

EMBL: AP009044.PE224

AP009044.PE224       Location/Qualifiers
FT   CDS             complement(231804..232214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53177"
FT                   /db_xref="GOA:A4QAD0"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAD0"
FT                   /protein_id="BAF53177.1"
FT                   /translation="MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVA
FT                   IVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPK
FT                   IVHVDADNRIVALGNDLAEALPGSGLLTSRSI"
     MLRTILGSKI HRATVTQADL DYVGSVTIDA DLVHAAGLIE GEKVAIVDIT NGARLETYVI        60
     VGDAGTGNIC INGAAAHLIN PGDLVIIMSY LQATDAEAKA YEPKIVHVDA DNRIVALGND       120
     LAEALPGSGL LTSRSI                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page