(data stored in ACNUC30630 zone)

EMBL: AP009044.PE226

AP009044.PE226       Location/Qualifiers
FT   CDS             complement(234025..235164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53179"
FT                   /db_xref="GOA:A4QAD2"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD2"
FT                   /protein_id="BAF53179.1"
FT                   /translation="MSDKEPDPHEQIPEKPSRKVIALRWCIVAPLSLAVGWLFTMWGVP
FT                   AAWILGAILVAGVCALTTGQDLPMAKGVHVFGRSIVAMLAALPLISASGSELIRFLIPG
FT                   LVISFFTIAVGIVGGLLLARSRPEILPETGVLSMLAGGASVMPILARELGADFRYVALT
FT                   QYLRLLVVSMTLPLVTHFFVPGGTDLGSPPEKWLDVLSLGEFGTSISVLSLLVLFGIVL
FT                   AGEPLGRLLRLPAPAVMGPLILTVLVSFVIPDDLSLQPPTVFKIIAFMAIGWMCGGALN
FT                   MTALKVFSKQLPATFLFIFALLAVCAGAAGLLTWWLDISFFEAYLATSPGALETVLALS
FT                   SEGSAGPVVVTIQIIRLLAILTIAGLIPTLLRRILRRDR"
     MSDKEPDPHE QIPEKPSRKV IALRWCIVAP LSLAVGWLFT MWGVPAAWIL GAILVAGVCA        60
     LTTGQDLPMA KGVHVFGRSI VAMLAALPLI SASGSELIRF LIPGLVISFF TIAVGIVGGL       120
     LLARSRPEIL PETGVLSMLA GGASVMPILA RELGADFRYV ALTQYLRLLV VSMTLPLVTH       180
     FFVPGGTDLG SPPEKWLDVL SLGEFGTSIS VLSLLVLFGI VLAGEPLGRL LRLPAPAVMG       240
     PLILTVLVSF VIPDDLSLQP PTVFKIIAFM AIGWMCGGAL NMTALKVFSK QLPATFLFIF       300
     ALLAVCAGAA GLLTWWLDIS FFEAYLATSP GALETVLALS SEGSAGPVVV TIQIIRLLAI       360
     LTIAGLIPTL LRRILRRDR                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page