(data stored in ACNUC30630 zone)

EMBL: AP009044.PE230

AP009044.PE230       Location/Qualifiers
FT   CDS             complement(237461..239989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53183"
FT                   /db_xref="GOA:A4QAD6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD6"
FT                   /protein_id="BAF53183.1"
FT                   /translation="MGISASPRRKNYFPQPARKHIIALGFSVEVRKKMCSPSRFLMYRQ
FT                   LMSSRIGNFLINRISTGLPVENIIPHLQEAFSAGPKNLVIQAPPGTGKTTLLPPLVANI
FT                   LCNEGAGNATPTKVLVTAPRRVAVRAAARRLAQLDGSQLGTKVGFSVRGEHIPGTHVQF
FT                   MTPGVLIRQLLNDPELPGIGAVIIDEVHERQLDSDLLTGMLAELSQLRDDFSLIAMSAT
FT                   LDSETFADLLDAQVLRAEAPIFPLDISYAPARTPRLNAKGVDWNFLDHMAQKTHEAIAH
FT                   SEHSALVFVPGVREIDRVINTLKSLGHNNVFPLHGQLSPAEQDCALTPSAQQRIIVSTP
FT                   VAESSLTVPGVRIVVDSGLSRSPKRDSARGMTGLITSSCAQASAGQRAGRAGREGPGQV
FT                   IRCYSEADFSHFPRFVAPEIGSANLTQAALWLAQWGTSPADLPLLDQPPHAAWSAAQQT
FT                   LRHIGALEGDAITSLGHRLSTLPLSPQLSASLLRFGEQSAKILAVVSENPQGDVEKQQP
FT                   DKREVERLRRLAPASAEKASAGQIVGAAFPQLIGRKIDNGEYLLASGTRARLIDPDLKD
FT                   AEWLSVAAINRSQNSAIIRAAAHISEADALEIIGVTEETRAVFVDGKVQARKVKAAGAI
FT                   ELSSTPTKPTPAEASEAIATALAKGGIDLFHFSDKAASLRDRLKFIHEHRGEPWPDIET
FT                   ADPHLWLSPEIEALSHGTRLNNIDMYPALQRLLPWPEATNFEEFAPPHLAAPSGNQHRL
FT                   DYSSGRPVVRVKLQECFGLEESPQLCGIPVQFHLLSPAGRPLAVTDDLRSFWSGPYSQV
FT                   RAEMRGRYPKHPWPEDPWTAPATARTKNRM"
     MGISASPRRK NYFPQPARKH IIALGFSVEV RKKMCSPSRF LMYRQLMSSR IGNFLINRIS        60
     TGLPVENIIP HLQEAFSAGP KNLVIQAPPG TGKTTLLPPL VANILCNEGA GNATPTKVLV       120
     TAPRRVAVRA AARRLAQLDG SQLGTKVGFS VRGEHIPGTH VQFMTPGVLI RQLLNDPELP       180
     GIGAVIIDEV HERQLDSDLL TGMLAELSQL RDDFSLIAMS ATLDSETFAD LLDAQVLRAE       240
     APIFPLDISY APARTPRLNA KGVDWNFLDH MAQKTHEAIA HSEHSALVFV PGVREIDRVI       300
     NTLKSLGHNN VFPLHGQLSP AEQDCALTPS AQQRIIVSTP VAESSLTVPG VRIVVDSGLS       360
     RSPKRDSARG MTGLITSSCA QASAGQRAGR AGREGPGQVI RCYSEADFSH FPRFVAPEIG       420
     SANLTQAALW LAQWGTSPAD LPLLDQPPHA AWSAAQQTLR HIGALEGDAI TSLGHRLSTL       480
     PLSPQLSASL LRFGEQSAKI LAVVSENPQG DVEKQQPDKR EVERLRRLAP ASAEKASAGQ       540
     IVGAAFPQLI GRKIDNGEYL LASGTRARLI DPDLKDAEWL SVAAINRSQN SAIIRAAAHI       600
     SEADALEIIG VTEETRAVFV DGKVQARKVK AAGAIELSST PTKPTPAEAS EAIATALAKG       660
     GIDLFHFSDK AASLRDRLKF IHEHRGEPWP DIETADPHLW LSPEIEALSH GTRLNNIDMY       720
     PALQRLLPWP EATNFEEFAP PHLAAPSGNQ HRLDYSSGRP VVRVKLQECF GLEESPQLCG       780
     IPVQFHLLSP AGRPLAVTDD LRSFWSGPYS QVRAEMRGRY PKHPWPEDPW TAPATARTKN       840
     RM                                                                      842
//

If you have problems or comments...

PBIL Back to PBIL home page