(data stored in ACNUC30630 zone)

EMBL: AP009044.PE234

AP009044.PE234       Location/Qualifiers
FT   CDS             241085..241777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53186"
FT                   /db_xref="GOA:A4QAD9"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD9"
FT                   /protein_id="BAF53186.1"
FT                   /translation="MPTLFDDPLHQLPRPPRRVAAGVVHLPNFLGLAEQKALVAQARDL
FT                   AREVVGTPLAMVRPKLKSGQMSVHMLHLGKYWASNPYRYVDVVDGFPVPPLPDSFVDLA
FT                   HRALLSAGSLSNSLQSWSEAYRAEAALVNYYSPDASMGMHQDANEESEAPVISLSIGDT
FT                   GIFRLGGTLNRNKPWTDIPLMSGDLIVFGGANRRAFHGIPFIEANTAPAGCGLKEGRIN
FT                   ITIRQLAL"
     MPTLFDDPLH QLPRPPRRVA AGVVHLPNFL GLAEQKALVA QARDLAREVV GTPLAMVRPK        60
     LKSGQMSVHM LHLGKYWASN PYRYVDVVDG FPVPPLPDSF VDLAHRALLS AGSLSNSLQS       120
     WSEAYRAEAA LVNYYSPDAS MGMHQDANEE SEAPVISLSI GDTGIFRLGG TLNRNKPWTD       180
     IPLMSGDLIV FGGANRRAFH GIPFIEANTA PAGCGLKEGR INITIRQLAL                  230
//

If you have problems or comments...

PBIL Back to PBIL home page