(data stored in ACNUC30630 zone)

EMBL: AP009044.PE238

AP009044.PE238       Location/Qualifiers
FT   CDS             243399..244253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53190"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE3"
FT                   /protein_id="BAF53190.1"
FT                   /translation="MPAFEAMPGMPYWIDLSTSDIAKSAHFYGNVLGWEIEEVNDGYRM
FT                   ARLQGLPVAGLIDQRGESSIPDTWITYFLSYDLDATAKKIAELGGRILAEPTDVHLGRM
FT                   ILAVDTAGALFGVIEPGSEESFVAAGEPGTSVWHELTTVSKYSEAIDFYGELFTWTTSE
FT                   MASAEDDSFRYTTALADGSAFAGIFDAKGHFPPQVPSFWQSYLGVLNADDAAAKAKEFG
FT                   GDVIRKPWDSEFGRMVLISDSTGATITLCEVEEYVEEAAEGDDLFDIDLSAFEEQFRKQ
FT                   EGQ"
     MPAFEAMPGM PYWIDLSTSD IAKSAHFYGN VLGWEIEEVN DGYRMARLQG LPVAGLIDQR        60
     GESSIPDTWI TYFLSYDLDA TAKKIAELGG RILAEPTDVH LGRMILAVDT AGALFGVIEP       120
     GSEESFVAAG EPGTSVWHEL TTVSKYSEAI DFYGELFTWT TSEMASAEDD SFRYTTALAD       180
     GSAFAGIFDA KGHFPPQVPS FWQSYLGVLN ADDAAAKAKE FGGDVIRKPW DSEFGRMVLI       240
     SDSTGATITL CEVEEYVEEA AEGDDLFDID LSAFEEQFRK QEGQ                        284
//

If you have problems or comments...

PBIL Back to PBIL home page