(data stored in ACNUC30630 zone)

EMBL: AP009044.PE240

AP009044.PE240       Location/Qualifiers
FT   CDS             244707..245600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53192"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE5"
FT                   /protein_id="BAF53192.1"
FT                   /translation="MKTPRLLKFLSAMVAVTGLLIPTVVPMAAADAAELSDNVPDRTQI
FT                   AIINPDGSVQESDNAEESRPALSLAKLYLGYYVLAQGAEEDIELVPDMIRYSDDFTADY
FT                   LESEYPEAIPEVIDAFDLEDTEWAGFWGNATTSAVDIATFVAALIDDPTAQPLLDAMSD
FT                   TAEYAADGYAQNFGTFTLSDVTGTKFGWSDSLDVHSSVSFGPGFVIAANTYGDAETLTE
FT                   DVQDSVSSLYPEEVTTAIEEQVDQLYECAAETTHLGMHTGAELKAQLEGTIYGKTLSFL
FT                   PNSAPVPAFIYNLLAR"
     MKTPRLLKFL SAMVAVTGLL IPTVVPMAAA DAAELSDNVP DRTQIAIINP DGSVQESDNA        60
     EESRPALSLA KLYLGYYVLA QGAEEDIELV PDMIRYSDDF TADYLESEYP EAIPEVIDAF       120
     DLEDTEWAGF WGNATTSAVD IATFVAALID DPTAQPLLDA MSDTAEYAAD GYAQNFGTFT       180
     LSDVTGTKFG WSDSLDVHSS VSFGPGFVIA ANTYGDAETL TEDVQDSVSS LYPEEVTTAI       240
     EEQVDQLYEC AAETTHLGMH TGAELKAQLE GTIYGKTLSF LPNSAPVPAF IYNLLAR          297
//

If you have problems or comments...

PBIL Back to PBIL home page