(data stored in ACNUC30630 zone)

EMBL: AP009044.PE242

AP009044.PE242       Location/Qualifiers
FT   CDS             246784..247098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53194"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE7"
FT                   /protein_id="BAF53194.1"
FT                   /translation="MHISGMVAFDSDANIVGEGDIEAQTEQVFRNLQAVVEEAGGTINN
FT                   IVSTTTYLADVTDAPVVNAARSRYFTGEVLPTHTVIGVAALARPQLLVEISAVAYLGDL
FT                   "
     MHISGMVAFD SDANIVGEGD IEAQTEQVFR NLQAVVEEAG GTINNIVSTT TYLADVTDAP        60
     VVNAARSRYF TGEVLPTHTV IGVAALARPQ LLVEISAVAY LGDL                        104
//

If you have problems or comments...

PBIL Back to PBIL home page