(data stored in ACNUC30630 zone)

EMBL: AP009044.PE248

AP009044.PE248       Location/Qualifiers
FT   CDS             252733..253476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53197"
FT                   /db_xref="GOA:A4QAF0"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF0"
FT                   /protein_id="BAF53197.1"
FT                   /translation="MSVIEGKYQLKPQGRGGLWWSIVGVAVVLLLLPTLINLVVPDKAN
FT                   DYKQLEIDLLGVDWSVPITTEESAAVLCEETSDEITQKYWDCNGDTTVVTMIVEGVKDP
FT                   SNTLRRMVGSSLITSVDDSLEAVSSEDGRAHALYVPGQQEGSVWTLPIVALSVQGSGDY
FT                   EDLTAIAIINGTSLDYYSTHIWSSMAADRGLPYQQDFPLMLEEQPWQDTPSGDLPFELP
FT                   NDFFDQYPDLFGRDSVIPNLEGESL"
     MSVIEGKYQL KPQGRGGLWW SIVGVAVVLL LLPTLINLVV PDKANDYKQL EIDLLGVDWS        60
     VPITTEESAA VLCEETSDEI TQKYWDCNGD TTVVTMIVEG VKDPSNTLRR MVGSSLITSV       120
     DDSLEAVSSE DGRAHALYVP GQQEGSVWTL PIVALSVQGS GDYEDLTAIA IINGTSLDYY       180
     STHIWSSMAA DRGLPYQQDF PLMLEEQPWQ DTPSGDLPFE LPNDFFDQYP DLFGRDSVIP       240
     NLEGESL                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page