(data stored in ACNUC30630 zone)

EMBL: AP009044.PE256

AP009044.PE256       Location/Qualifiers
FT   CDS             262338..263294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53205"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF8"
FT                   /protein_id="BAF53205.1"
FT                   /translation="MTTSVPASTKAPSVAGENPGLRIGTAPDSWGVWFPEDPKQIPWER
FT                   FLDEVVKAGYTWIELGPYGYLPTDANQLEDELGKRGLKLSAGTVFTGFHKGEEQWKRAW
FT                   DQALDVAGLASKLGAEHLVVIPDLWRSDATNEVLEARTLDDEKWAKLAAGHDRLGKALL
FT                   EEFGMKQQFHSHADSHIGTTREVLRFLEETDARYTNLCLDTGHFAYYGGDNVKLIEQHP
FT                   ERIGYLHLKQVDPTLLFDVLKNDTPFAEAVTQGIMIEPPHGIPDLAPIIEAVSKIDSEI
FT                   FAIVEQDMYGCDIDYPFPIAERTRKHIFGCTHFARVN"
     MTTSVPASTK APSVAGENPG LRIGTAPDSW GVWFPEDPKQ IPWERFLDEV VKAGYTWIEL        60
     GPYGYLPTDA NQLEDELGKR GLKLSAGTVF TGFHKGEEQW KRAWDQALDV AGLASKLGAE       120
     HLVVIPDLWR SDATNEVLEA RTLDDEKWAK LAAGHDRLGK ALLEEFGMKQ QFHSHADSHI       180
     GTTREVLRFL EETDARYTNL CLDTGHFAYY GGDNVKLIEQ HPERIGYLHL KQVDPTLLFD       240
     VLKNDTPFAE AVTQGIMIEP PHGIPDLAPI IEAVSKIDSE IFAIVEQDMY GCDIDYPFPI       300
     AERTRKHIFG CTHFARVN                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page