(data stored in ACNUC30630 zone)

EMBL: AP009044.PE263

AP009044.PE263       Location/Qualifiers
FT   CDS             complement(268703..269701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53212"
FT                   /db_xref="GOA:A4QAG5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG5"
FT                   /protein_id="BAF53212.1"
FT                   /translation="MSTSRPTIYDVAKAAGVSKSLVSLVLRGSTNVSKESEAAVKTAIK
FT                   KLNYQPNRAASDLAAKRTQLIAVLIDDYSNPWFIDLIQSLSDVLTPKGYRLSVIDSLTS
FT                   QAGTDPITSALSMRPDGIIIAQDIPDFTVPDSLPPFVIAGTRITQASTHYSVANDDFRG
FT                   AEIATKHLIDLGHTHIAHLRVGSGAGLRRFESFEETMRAHGLEPLSNDYLGPAVEHAGY
FT                   TETLALLKEHPEVTAIFSSNDITAIGALGAARELGLRVPEDLSIIGYDNTPLAQTRLIN
FT                   LTTIDDNSIGVGYNAALLLLSMLDPEAPHPEIMHTLQPSLIERGTCAPRGG"
     MSTSRPTIYD VAKAAGVSKS LVSLVLRGST NVSKESEAAV KTAIKKLNYQ PNRAASDLAA        60
     KRTQLIAVLI DDYSNPWFID LIQSLSDVLT PKGYRLSVID SLTSQAGTDP ITSALSMRPD       120
     GIIIAQDIPD FTVPDSLPPF VIAGTRITQA STHYSVANDD FRGAEIATKH LIDLGHTHIA       180
     HLRVGSGAGL RRFESFEETM RAHGLEPLSN DYLGPAVEHA GYTETLALLK EHPEVTAIFS       240
     SNDITAIGAL GAARELGLRV PEDLSIIGYD NTPLAQTRLI NLTTIDDNSI GVGYNAALLL       300
     LSMLDPEAPH PEIMHTLQPS LIERGTCAPR GG                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page