(data stored in ACNUC30630 zone)

EMBL: AP009044.PE264

AP009044.PE264       Location/Qualifiers
FT   CDS             269842..271071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53213"
FT                   /db_xref="GOA:A4QAG6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG6"
FT                   /protein_id="BAF53213.1"
FT                   /translation="MTQQELRVAVIGAGMAGKAHAAGYRTASSIYSTTLPNIRLVSIAD
FT                   ANVQLAEETAARFGFERFDTSWQAIVEADDIDVVSVVVANFLHREIVEALLASGKHVLC
FT                   EKPLSDTIEDAEAMIEAAGRAATNGTIARIGLTYRRSPGVAHIRDLVQSGELGKVLHVT
FT                   GHYWTDYGSNAQAPISWRYKGPNGSGALADVGSHLTYLAEFVAGSDFADVRGGQLSTVI
FT                   TERPKPLGAIVGHEGGAVSDEYEAVENDDIASFSGSFISGGTATLQVGRISQGHPNTLG
FT                   FEVFCEKGSVLFDFRNSGEFKIFTPATSGDISQEAGYRTITIGPKHPYWRGGLAMDAPG
FT                   VGIGQNEGFVFQARAFLEEIAGIPEEESLPRCATLEEGLHNMQLIDAVAQSAAADGATV
FT                   AVPVLAPVQN"
     MTQQELRVAV IGAGMAGKAH AAGYRTASSI YSTTLPNIRL VSIADANVQL AEETAARFGF        60
     ERFDTSWQAI VEADDIDVVS VVVANFLHRE IVEALLASGK HVLCEKPLSD TIEDAEAMIE       120
     AAGRAATNGT IARIGLTYRR SPGVAHIRDL VQSGELGKVL HVTGHYWTDY GSNAQAPISW       180
     RYKGPNGSGA LADVGSHLTY LAEFVAGSDF ADVRGGQLST VITERPKPLG AIVGHEGGAV       240
     SDEYEAVEND DIASFSGSFI SGGTATLQVG RISQGHPNTL GFEVFCEKGS VLFDFRNSGE       300
     FKIFTPATSG DISQEAGYRT ITIGPKHPYW RGGLAMDAPG VGIGQNEGFV FQARAFLEEI       360
     AGIPEEESLP RCATLEEGLH NMQLIDAVAQ SAAADGATVA VPVLAPVQN                   409
//

If you have problems or comments...

PBIL Back to PBIL home page