(data stored in ACNUC30630 zone)

EMBL: AP009044.PE267

AP009044.PE267       Location/Qualifiers
FT   CDS             273087..274805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53216"
FT                   /db_xref="GOA:A4QAG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG9"
FT                   /protein_id="BAF53216.1"
FT                   /translation="MMAALFVYIMAIPVIMMIKDAVTVQPADGVKTGQGPGELTSYYLW
FT                   RTLRSPVSVDLFWRPLGNTLSIALVVIFLTLIFGTFLALLVQKSNVYGRKWFATALIIP
FT                   YVLPSWTFALAWQTIFTNRTTGGQSGWLENAGLNPPDWLAYGRIPMIIIFTLHYGPLVF
FT                   LLISNSLSRIDSRNEEAALNAGADRLTVLWKITLPLLRPAILSASTLVLAKSIGEFGAA
FT                   YVIGLPVNFSVLSTSLYQSINTRQTGVAAVLAGALILIGAIGLFADYLFLRNARKYVTI
FT                   TGKGNSSRVNPLGSWRIPATALVGLAFATSVLLPLGTLLLSTIMRYPGNFELSNFTLDY
FT                   WIGHNLPTQAFRDGLLINSKLWSALWNTVWIAAIAAAAAALMGMLTGYAVTRTTSSPLA
FT                   NLLKQLAFIPYLVPGISFAVAYLSLFAVQRGPIPPLYGTTFILILILAADEVPFASRSG
FT                   ISSMMQLGKESEEASLNAGASWGRTIAMIVLPIQKSALAAAFVLPFISATQALSPVIIL
FT                   ATSETNLLTTLSMNLVDYGYTHAANGVTLMICLVALLGMVITRKVLKVDMGKGIS"
     MMAALFVYIM AIPVIMMIKD AVTVQPADGV KTGQGPGELT SYYLWRTLRS PVSVDLFWRP        60
     LGNTLSIALV VIFLTLIFGT FLALLVQKSN VYGRKWFATA LIIPYVLPSW TFALAWQTIF       120
     TNRTTGGQSG WLENAGLNPP DWLAYGRIPM IIIFTLHYGP LVFLLISNSL SRIDSRNEEA       180
     ALNAGADRLT VLWKITLPLL RPAILSASTL VLAKSIGEFG AAYVIGLPVN FSVLSTSLYQ       240
     SINTRQTGVA AVLAGALILI GAIGLFADYL FLRNARKYVT ITGKGNSSRV NPLGSWRIPA       300
     TALVGLAFAT SVLLPLGTLL LSTIMRYPGN FELSNFTLDY WIGHNLPTQA FRDGLLINSK       360
     LWSALWNTVW IAAIAAAAAA LMGMLTGYAV TRTTSSPLAN LLKQLAFIPY LVPGISFAVA       420
     YLSLFAVQRG PIPPLYGTTF ILILILAADE VPFASRSGIS SMMQLGKESE EASLNAGASW       480
     GRTIAMIVLP IQKSALAAAF VLPFISATQA LSPVIILATS ETNLLTTLSM NLVDYGYTHA       540
     ANGVTLMICL VALLGMVITR KVLKVDMGKG IS                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page