(data stored in ACNUC30630 zone)

EMBL: AP009044.PE268

AP009044.PE268       Location/Qualifiers
FT   CDS             274917..276086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53217"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH0"
FT                   /protein_id="BAF53217.1"
FT                   /translation="MKAKYLITTAAFAVSAIALTACTPSTAEADSESSQTSIANAAAVE
FT                   TVIEDVDLDALLEAAKDEPALQVYDGTSKIEKIAENFAEHYGLEITGSKADSSEVTEMM
FT                   IREHAAGNVQGDVFALSDLAAVNNELLANGSATAWLPADIAKNMDDSAINPPVVINDPS
FT                   LFTYNAEVNDVCPADNIWEFTDAASGQRLAFQDPLNDSGTLDWFSQMSQFASDELESSY
FT                   ASYFGEEFTGDDITEEFVAKLASNNPLLTKSSEEASEAVGAPGQTEPPMGLISSAKFRN
FT                   NDELGYKLAACDTLEPFVGYANPKAIVMASGTDSPNAAKLFIHWMYTQEGIEPQIADGK
FT                   ISTNSEIVQPEDPANVGELTDRIFTFDGSGVDTDWANREDWSDLWRMNS"
     MKAKYLITTA AFAVSAIALT ACTPSTAEAD SESSQTSIAN AAAVETVIED VDLDALLEAA        60
     KDEPALQVYD GTSKIEKIAE NFAEHYGLEI TGSKADSSEV TEMMIREHAA GNVQGDVFAL       120
     SDLAAVNNEL LANGSATAWL PADIAKNMDD SAINPPVVIN DPSLFTYNAE VNDVCPADNI       180
     WEFTDAASGQ RLAFQDPLND SGTLDWFSQM SQFASDELES SYASYFGEEF TGDDITEEFV       240
     AKLASNNPLL TKSSEEASEA VGAPGQTEPP MGLISSAKFR NNDELGYKLA ACDTLEPFVG       300
     YANPKAIVMA SGTDSPNAAK LFIHWMYTQE GIEPQIADGK ISTNSEIVQP EDPANVGELT       360
     DRIFTFDGSG VDTDWANRED WSDLWRMNS                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page