(data stored in ACNUC30630 zone)

EMBL: AP009044.PE272

AP009044.PE272       Location/Qualifiers
FT   CDS             279035..279607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53221"
FT                   /db_xref="GOA:A4QAH4"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH4"
FT                   /protein_id="BAF53221.1"
FT                   /translation="MTPDLAAFLDQLYADGRDFDAGQPDRLDRRRNLEPESAALLRSLI
FT                   DGLTPKSVLELGTSNGYSTIWMADVTNLTTVDNDPGRSLDAAANLRAAGVEEKVQRIVA
FT                   DGATVLTDSADEQWDFIFLDAERSLYVNWWPDLQRVLANGGLLVVDNVLSHADQVVSFR
FT                   EHVDQTEGLRSLVLPIGAGLLIIAKQS"
     MTPDLAAFLD QLYADGRDFD AGQPDRLDRR RNLEPESAAL LRSLIDGLTP KSVLELGTSN        60
     GYSTIWMADV TNLTTVDNDP GRSLDAAANL RAAGVEEKVQ RIVADGATVL TDSADEQWDF       120
     IFLDAERSLY VNWWPDLQRV LANGGLLVVD NVLSHADQVV SFREHVDQTE GLRSLVLPIG       180
     AGLLIIAKQS                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page