(data stored in ACNUC30630 zone)

EMBL: AP009044.PE277

AP009044.PE277       Location/Qualifiers
FT   CDS             complement(284310..284747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53226"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH9"
FT                   /protein_id="BAF53226.1"
FT                   /translation="MVDFDTIAARLVTETEEAIIYATRDGIIRLWNGGSEKLFGYTAGE
FT                   ALGKSLDIIIPEKHRKAHWDGWDRVMESGKTRYGSEPLNVPGIRADGSKMSLEFSITIL
FT                   KDDSGKIEGVAAFLRDVTANWDEKKALRIRIKELERQIEGQ"
     MVDFDTIAAR LVTETEEAII YATRDGIIRL WNGGSEKLFG YTAGEALGKS LDIIIPEKHR        60
     KAHWDGWDRV MESGKTRYGS EPLNVPGIRA DGSKMSLEFS ITILKDDSGK IEGVAAFLRD       120
     VTANWDEKKA LRIRIKELER QIEGQ                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page