(data stored in ACNUC30630 zone)

EMBL: AP009044.PE278

AP009044.PE278       Location/Qualifiers
FT   CDS             284949..289481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53227"
FT                   /db_xref="GOA:A4QAI0"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI0"
FT                   /protein_id="BAF53227.1"
FT                   /translation="MKPQGLYNPAHEHDACGVAFIADIHGRPSRSIVDRALEALRNIDH
FT                   RGAAGAEKNTGDGAGILMQIPDGFYREVSGIELPEAGEYATGIAFLPRGRMAMMDAQKE
FT                   IERIAKQEGADVLGWRMVPFDSRELGSMAEEAMPSFAQIFLTVPGKSGEDLDRVMFFIR
FT                   KRCERELGTTNGRDTVYFPSLSSRTIIYKGMLTTLQLEGFFEDLGDARLESAIAIVHSR
FT                   FSTNTFPSWPLAHPYRFVAHNGEINTVRGNENWMRAREALIKNDKLGNLSSVLPICTPE
FT                   GSDTARFDEALELLHLGGYSLPHAVAMMIPQAWEHNKTLSPELRDFYEYHSCLMEPWDG
FT                   PAALAFTDGRFVGAVLDRNGLRPGRITITDSGLVVMASESGVLDLREESVVKRTRVQPG
FT                   RMFLVDTAEGRIVEDEEIKQKLSEAQPYGEWIRDNFVHLDRLPQTRYNYMAHSRAVLRQ
FT                   RVFGITEEDVDLLLLPMARQGAEAIGSMGSDTPIAALSQRPRMLYDFFAQRFAQVTNPP
FT                   LDSIREKPVTSMYTLLGAQSDVLNPGPDAARRIRLESPIIDNHELATLINANAHGEWDS
FT                   FGAAVISGLYPVAHHGAGMKAAIARVRREVSEAIRNGKTLIVLSDRESDERMAPIPALL
FT                   LTSAVHQYLVQQRTRTQCSLVVESGDAREVHHLAMLIGFGADAINPYMAFETIDELRMK
FT                   GQLDDLSLDEASRNYIKAATTGVLKVMSKMGIATVSSYRGAQLADVTGLHQDLLDNYFG
FT                   GIASPISGIGLDEVAADVEARHRSAFLPRPEEHAHRELDLGGEYKWRREGEYHLFNPET
FT                   IFKLQHATRSGSYEIFKDYTRKVDDQSTRLGTIRGLFEFSTDRKPISVSEVEPVSEIVK
FT                   RFSTGAMSYGSISAEAHEVLAIAMNRLGGMSNSGEGGEDARRFDVEPNGDWKRSAIKQV
FT                   ASGRFGVTSHYLNNCTDIQIKMAQGAKPGEGGQLPPNKVYPWVAEVRITTPGVGLISPP
FT                   PHHDIYSIEDLAQLIHDLKNANPRARIHVKLVAEQGVGTVAAGVSKAHADVVLISGHDG
FT                   GTGASPLTSLKHAGGPWELGLAETQQTLLLNGLRDRIRVQCDGQLKTGRDVVIAALLGA
FT                   EEFGFATAPLVVEGCIMMRVCHLDTCPVGIATQNPDLRSKFTGKAEHVVNFFTFIAQEV
FT                   REYLAQLGFRSIDEAVGQAQVLRKRSGIPADSRAAHLDLSPIFHRPETPHFPTQDVRCT
FT                   KTQEHSLEKALDNAFIDKASDTITRAAAGVETSIVIDSSISNVNRSVGTMLGSAVSRVA
FT                   GAQGLPDGTITLNLQGCAGNSFGAFIPRGITINLTGDANDFVGKGLSGGKIVIKPSAQA
FT                   PKQLKNNPNIIAGNVLGYGATSGELFIRGQVGERFCVRNSGATAVVEGIGNHGCEYMTG
FT                   GRVLVLGPVGENFGAGMSGGIAYLANSPDLNQKINGELVDVVPLSADDLTWADELIARH
FT                   RELTGSETKLRAQDLVKIMPRDFQKVLNIIETAHAEGQDPAIKIMEAVS"
     MKPQGLYNPA HEHDACGVAF IADIHGRPSR SIVDRALEAL RNIDHRGAAG AEKNTGDGAG        60
     ILMQIPDGFY REVSGIELPE AGEYATGIAF LPRGRMAMMD AQKEIERIAK QEGADVLGWR       120
     MVPFDSRELG SMAEEAMPSF AQIFLTVPGK SGEDLDRVMF FIRKRCEREL GTTNGRDTVY       180
     FPSLSSRTII YKGMLTTLQL EGFFEDLGDA RLESAIAIVH SRFSTNTFPS WPLAHPYRFV       240
     AHNGEINTVR GNENWMRARE ALIKNDKLGN LSSVLPICTP EGSDTARFDE ALELLHLGGY       300
     SLPHAVAMMI PQAWEHNKTL SPELRDFYEY HSCLMEPWDG PAALAFTDGR FVGAVLDRNG       360
     LRPGRITITD SGLVVMASES GVLDLREESV VKRTRVQPGR MFLVDTAEGR IVEDEEIKQK       420
     LSEAQPYGEW IRDNFVHLDR LPQTRYNYMA HSRAVLRQRV FGITEEDVDL LLLPMARQGA       480
     EAIGSMGSDT PIAALSQRPR MLYDFFAQRF AQVTNPPLDS IREKPVTSMY TLLGAQSDVL       540
     NPGPDAARRI RLESPIIDNH ELATLINANA HGEWDSFGAA VISGLYPVAH HGAGMKAAIA       600
     RVRREVSEAI RNGKTLIVLS DRESDERMAP IPALLLTSAV HQYLVQQRTR TQCSLVVESG       660
     DAREVHHLAM LIGFGADAIN PYMAFETIDE LRMKGQLDDL SLDEASRNYI KAATTGVLKV       720
     MSKMGIATVS SYRGAQLADV TGLHQDLLDN YFGGIASPIS GIGLDEVAAD VEARHRSAFL       780
     PRPEEHAHRE LDLGGEYKWR REGEYHLFNP ETIFKLQHAT RSGSYEIFKD YTRKVDDQST       840
     RLGTIRGLFE FSTDRKPISV SEVEPVSEIV KRFSTGAMSY GSISAEAHEV LAIAMNRLGG       900
     MSNSGEGGED ARRFDVEPNG DWKRSAIKQV ASGRFGVTSH YLNNCTDIQI KMAQGAKPGE       960
     GGQLPPNKVY PWVAEVRITT PGVGLISPPP HHDIYSIEDL AQLIHDLKNA NPRARIHVKL      1020
     VAEQGVGTVA AGVSKAHADV VLISGHDGGT GASPLTSLKH AGGPWELGLA ETQQTLLLNG      1080
     LRDRIRVQCD GQLKTGRDVV IAALLGAEEF GFATAPLVVE GCIMMRVCHL DTCPVGIATQ      1140
     NPDLRSKFTG KAEHVVNFFT FIAQEVREYL AQLGFRSIDE AVGQAQVLRK RSGIPADSRA      1200
     AHLDLSPIFH RPETPHFPTQ DVRCTKTQEH SLEKALDNAF IDKASDTITR AAAGVETSIV      1260
     IDSSISNVNR SVGTMLGSAV SRVAGAQGLP DGTITLNLQG CAGNSFGAFI PRGITINLTG      1320
     DANDFVGKGL SGGKIVIKPS AQAPKQLKNN PNIIAGNVLG YGATSGELFI RGQVGERFCV      1380
     RNSGATAVVE GIGNHGCEYM TGGRVLVLGP VGENFGAGMS GGIAYLANSP DLNQKINGEL      1440
     VDVVPLSADD LTWADELIAR HRELTGSETK LRAQDLVKIM PRDFQKVLNI IETAHAEGQD      1500
     PAIKIMEAVS                                                             1510
//

If you have problems or comments...

PBIL Back to PBIL home page