(data stored in ACNUC30630 zone)

EMBL: AP009044.PE279

AP009044.PE279       Location/Qualifiers
FT   CDS             289481..291001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53228"
FT                   /db_xref="GOA:A4QAI1"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI1"
FT                   /protein_id="BAF53228.1"
FT                   /translation="MADPQGFIKYSRREPAHRPVPLRLMDYSEVYEKAPAGQIEEQAAR
FT                   CMDCGVPFCHEGCPLGNIIPEWNDLVRQGRWKEAYDRLHATNNFPEFTGRLCPAPCEGA
FT                   CVLGINDDSVTIKNVELEIVEKAFREGWVQPVIPSMSTGLSVAVVGSGPAGLAAAQQLT
FT                   RAGHSVTVFERDDRLGGLMRYGVPEYKMENRWIDRRIEQMEAEGTTFQVGTSPRAAELA
FT                   LFDAILLATGTPVARELSVPGDDLNGIHAAMDYLTAQNRINEGDGDVSPINAKGKKVVI
FT                   IGGGDTGTDCFGTALRQGAESVTQFDIRPRAPFQRADSTPWPMYPNLFRTATAHEEGEY
FT                   IITGDESADEIAALGLAERAAGSTLGERKFAVNTVEFHGNNGHVTGLTGNQIRVVNGKR
FT                   EPIEGTEFPFEADLVLVALGFTGAEQGGLAHELGVGFDDRGRILRDSEYRSPTNSRVYI
FT                   AGDNGRGQSLIVWAIAEGRACAAAIDADLMGETALPVAVAPQDVPLAV"
     MADPQGFIKY SRREPAHRPV PLRLMDYSEV YEKAPAGQIE EQAARCMDCG VPFCHEGCPL        60
     GNIIPEWNDL VRQGRWKEAY DRLHATNNFP EFTGRLCPAP CEGACVLGIN DDSVTIKNVE       120
     LEIVEKAFRE GWVQPVIPSM STGLSVAVVG SGPAGLAAAQ QLTRAGHSVT VFERDDRLGG       180
     LMRYGVPEYK MENRWIDRRI EQMEAEGTTF QVGTSPRAAE LALFDAILLA TGTPVARELS       240
     VPGDDLNGIH AAMDYLTAQN RINEGDGDVS PINAKGKKVV IIGGGDTGTD CFGTALRQGA       300
     ESVTQFDIRP RAPFQRADST PWPMYPNLFR TATAHEEGEY IITGDESADE IAALGLAERA       360
     AGSTLGERKF AVNTVEFHGN NGHVTGLTGN QIRVVNGKRE PIEGTEFPFE ADLVLVALGF       420
     TGAEQGGLAH ELGVGFDDRG RILRDSEYRS PTNSRVYIAG DNGRGQSLIV WAIAEGRACA       480
     AAIDADLMGE TALPVAVAPQ DVPLAV                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page