(data stored in ACNUC30630 zone)

EMBL: AP009044.PE291

AP009044.PE291       Location/Qualifiers
FT   CDS             303891..304526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53240"
FT                   /db_xref="GOA:A4QAJ3"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ3"
FT                   /protein_id="BAF53240.1"
FT                   /translation="MPGLVLSTNVAHIQQDPGGDDRISGINKLPVATGIDVFIPGPNYG
FT                   DGSGVVGDAIGDSLHHGGAHKAIYAYSREELDFFDPTYRNGYFGENLTTSGIVLEDLLI
FT                   NQQVRIGTTLLEVSIPRRPCRTFAHWLDIKGWLKTFTQRGLPGSYFRVIEEGHINPGDP
FT                   IEVLQAPDHDITMSMAFRAKMGNKDLARRVVAANCLPARYHEELLKLI"
     MPGLVLSTNV AHIQQDPGGD DRISGINKLP VATGIDVFIP GPNYGDGSGV VGDAIGDSLH        60
     HGGAHKAIYA YSREELDFFD PTYRNGYFGE NLTTSGIVLE DLLINQQVRI GTTLLEVSIP       120
     RRPCRTFAHW LDIKGWLKTF TQRGLPGSYF RVIEEGHINP GDPIEVLQAP DHDITMSMAF       180
     RAKMGNKDLA RRVVAANCLP ARYHEELLKL I                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page