(data stored in ACNUC30630 zone)

EMBL: AP009044.PE299

AP009044.PE299       Location/Qualifiers
FT   CDS             311608..311721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53248"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK1"
FT                   /protein_id="BAF53248.1"
FT                   /translation="MLNNEVLSNYEIVSENQVLACQTIRDADGPYHCSFDD"
     MLNNEVLSNY EIVSENQVLA CQTIRDADGP YHCSFDD                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page