(data stored in ACNUC30630 zone)

EMBL: AP009044.PE30

AP009044.PE30        Location/Qualifiers
FT   CDS             34804..35556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52991"
FT                   /db_xref="GOA:A4Q9U8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U8"
FT                   /protein_id="BAF52991.1"
FT                   /translation="MTISEFLQRRLTESGVVLAYHDIIDDSASIYPYAVRESTFRAQIN
FT                   LARRLGFEFIPLSSLVEALLSRASVSGKAALLFDDALRGVHLRAMPYLSEESIPWSLLP
FT                   VVDRLGVFPDWWEPADRTMTLDEVLEAVDSGAQLCGHTATHPSLPKLDDVSMLMELQHS
FT                   REKLSDWGNREVLDMCYPFGHQDARVRKLAREAGYRSGWSFTNGRCHPADDPFSLARMA
FT                   MREDMSGARFAKFLLRPRWTWPAVEELS"
     MTISEFLQRR LTESGVVLAY HDIIDDSASI YPYAVRESTF RAQINLARRL GFEFIPLSSL        60
     VEALLSRASV SGKAALLFDD ALRGVHLRAM PYLSEESIPW SLLPVVDRLG VFPDWWEPAD       120
     RTMTLDEVLE AVDSGAQLCG HTATHPSLPK LDDVSMLMEL QHSREKLSDW GNREVLDMCY       180
     PFGHQDARVR KLAREAGYRS GWSFTNGRCH PADDPFSLAR MAMREDMSGA RFAKFLLRPR       240
     WTWPAVEELS                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page