(data stored in ACNUC30630 zone)

EMBL: AP009044.PE305

AP009044.PE305       Location/Qualifiers
FT   CDS             complement(316268..316729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53253"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK6"
FT                   /protein_id="BAF53253.1"
FT                   /translation="MTALVIVASTRAAAGVYEDRSGPILVSWLRAKGFDTPDPVIVADA
FT                   DLPAFLDELKFPQVVLISGGTGLTPDDITVDTLIPRLDKEIPGIAHAFWNYSMDAVPTA
FT                   VLSRTVAGTIGSSFIMALPGSTGAARDATAVLDPLIDHITGTLQGHHEH"
     MTALVIVAST RAAAGVYEDR SGPILVSWLR AKGFDTPDPV IVADADLPAF LDELKFPQVV        60
     LISGGTGLTP DDITVDTLIP RLDKEIPGIA HAFWNYSMDA VPTAVLSRTV AGTIGSSFIM       120
     ALPGSTGAAR DATAVLDPLI DHITGTLQGH HEH                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page