(data stored in ACNUC30630 zone)

EMBL: AP009044.PE307

AP009044.PE307       Location/Qualifiers
FT   CDS             complement(317211..318398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53255"
FT                   /db_xref="GOA:A4QAK8"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK8"
FT                   /protein_id="BAF53255.1"
FT                   /translation="MMSRSPEQHLAEISALLPPQKSTFVNLREALGRRTFTAVTAQWDS
FT                   PRFDNSQMDGFALGPSHLNGGTFAVGPTIPAGHDPDQWYPRGIEKDIAPIMTGARLPKN
FT                   TAAIIPVEKTTPGNFDAPQVEIPATPQGQFIRLQGSDITAGDEIIPGGTELNSMHIGVL
FT                   ASQSIKSIEVAAKPRVLIITGGSEISEQHGPATIPDANGPLLRSLCARNNIEVIAGLHT
FT                   NDDPERLRFELDNAIDQYQPDAIITSGGISHGKFEVFRQILEGSPNSWFGHVDQQPGGP
FT                   QGISTFAETPVISLPGNPISTLVSFTLFVAPALNRQPLRHLDAHITAPVQGLQDNREQF
FT                   LRGTINYANGKVLATPLLGTSSHLLVQAATANCLIRIPARTTVEENDIVKIYPFN"
     MMSRSPEQHL AEISALLPPQ KSTFVNLREA LGRRTFTAVT AQWDSPRFDN SQMDGFALGP        60
     SHLNGGTFAV GPTIPAGHDP DQWYPRGIEK DIAPIMTGAR LPKNTAAIIP VEKTTPGNFD       120
     APQVEIPATP QGQFIRLQGS DITAGDEIIP GGTELNSMHI GVLASQSIKS IEVAAKPRVL       180
     IITGGSEISE QHGPATIPDA NGPLLRSLCA RNNIEVIAGL HTNDDPERLR FELDNAIDQY       240
     QPDAIITSGG ISHGKFEVFR QILEGSPNSW FGHVDQQPGG PQGISTFAET PVISLPGNPI       300
     STLVSFTLFV APALNRQPLR HLDAHITAPV QGLQDNREQF LRGTINYANG KVLATPLLGT       360
     SSHLLVQAAT ANCLIRIPAR TTVEENDIVK IYPFN                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page