(data stored in ACNUC30630 zone)

EMBL: AP009044.PE314

AP009044.PE314       Location/Qualifiers
FT   CDS             323698..325008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53262"
FT                   /db_xref="GOA:A4QAL5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAL5"
FT                   /protein_id="BAF53262.1"
FT                   /translation="MKELDLGEAHGVAATLEAMPIQEVIDQVERTPIAEGAVLLRLLSK
FT                   DRSLLVFDALNPRLQADLIGAFQDAEVLDYFADLDPDDRVSLLDELPASIADELLRSLD
FT                   PQAKQVTELVLGYAKRSVGRWMSPQVLLLYDDMSVAEVLDYVRNHAAEAETIYALPIVN
FT                   RARQVVGVVSLRKLFIADPALKVSEVMVRPVSVLASADAEETARWFLQLDLVAMPVVDE
FT                   SDMLVGVLTFDDAQDIVEQAESEDSARSGGSEPLQQPYLSTPIRKLVKSRIVWLLVLAV
FT                   SAILTVQVLDVFEATLAEAVVLALFIPLLTGTGGNTGNQAATTVTRALALGDIRKSDVF
FT                   RVLGREIRVGLMLGALLGGVGFVIASLVYGMPVGTVIGLTLLAVCTMAASVGGVMPIIA
FT                   KAIGADPAVFSNPFISTFCDATGLIIYFAIAKLVLGI"
     MKELDLGEAH GVAATLEAMP IQEVIDQVER TPIAEGAVLL RLLSKDRSLL VFDALNPRLQ        60
     ADLIGAFQDA EVLDYFADLD PDDRVSLLDE LPASIADELL RSLDPQAKQV TELVLGYAKR       120
     SVGRWMSPQV LLLYDDMSVA EVLDYVRNHA AEAETIYALP IVNRARQVVG VVSLRKLFIA       180
     DPALKVSEVM VRPVSVLASA DAEETARWFL QLDLVAMPVV DESDMLVGVL TFDDAQDIVE       240
     QAESEDSARS GGSEPLQQPY LSTPIRKLVK SRIVWLLVLA VSAILTVQVL DVFEATLAEA       300
     VVLALFIPLL TGTGGNTGNQ AATTVTRALA LGDIRKSDVF RVLGREIRVG LMLGALLGGV       360
     GFVIASLVYG MPVGTVIGLT LLAVCTMAAS VGGVMPIIAK AIGADPAVFS NPFISTFCDA       420
     TGLIIYFAIA KLVLGI                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page