(data stored in ACNUC30630 zone)

EMBL: AP009044.PE327

AP009044.PE327       Location/Qualifiers
FT   CDS             complement(338337..339344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53275"
FT                   /db_xref="GOA:A4QAM8"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM8"
FT                   /protein_id="BAF53275.1"
FT                   /translation="MAEQLRQFEGRVLPNQSEDLEDQGLGFDLGTVFSRRKVLGFIGVG
FT                   GAGVALAACSPSGSSAASSTSSASSSAAATSSAAAETLTEMKSETAGPYPGDGSNGPDV
FT                   LEVSGVERQDITKSIDTDTVAEGVPLTLTMTILDMNNNNQPMEGAAVYIWHCDAPGRYS
FT                   MYDDELLEETYLRGVQITDKYGQVTFDTIFPGCYAGRWVHIHFEVFPDRESISDSTNNI
FT                   LTSQIALDEASAASVYALDVYGDSLTNLNNITLESDNVFSDGWDQQMANLTGDATSGFI
FT                   ASIDVPIDPTTEQDQSMNMPSGGGMGGGPSGGGMGGPGEGMTPPDGMTPPSEPQ"
     MAEQLRQFEG RVLPNQSEDL EDQGLGFDLG TVFSRRKVLG FIGVGGAGVA LAACSPSGSS        60
     AASSTSSASS SAAATSSAAA ETLTEMKSET AGPYPGDGSN GPDVLEVSGV ERQDITKSID       120
     TDTVAEGVPL TLTMTILDMN NNNQPMEGAA VYIWHCDAPG RYSMYDDELL EETYLRGVQI       180
     TDKYGQVTFD TIFPGCYAGR WVHIHFEVFP DRESISDSTN NILTSQIALD EASAASVYAL       240
     DVYGDSLTNL NNITLESDNV FSDGWDQQMA NLTGDATSGF IASIDVPIDP TTEQDQSMNM       300
     PSGGGMGGGP SGGGMGGPGE GMTPPDGMTP PSEPQ                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page