(data stored in ACNUC30630 zone)

EMBL: AP009044.PE33

AP009044.PE33        Location/Qualifiers
FT   CDS             38006..39124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52994"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V1"
FT                   /protein_id="BAF52994.1"
FT                   /translation="MARIAIAHERWTDIAGSEQVTQQLTKTWSETSVHVPFAKKSLIPE
FT                   DLRDSFHISPLQVAYQLIRQRTYAPLLPLVPPAMQWGSLRQAHDVDAVVVSHHAFALAA
FT                   VGAAQAINKPSVAYVHSPARWAWDARFRQEEEHSRAGKAALSVLSARARANETRWAPHV
FT                   TSIMGNSSAVVKRIEQHWNREAQVVHPPVDTEFFHPDEAIEKGDYFISVGRLVPYKQVP
FT                   LGVAAAVAAGVRLVVVGDGRDMDRARAFAGPNVEFKGRLPGDEMRDLIRGARALLMPGE
FT                   EDFGIVPVEAMACGTPVIALGKGGALDTVKPGISGELFSGDGEKEVIANLAEVLKNFDD
FT                   SRFNISTLRNWAEGFSEAAFREKMAEVVDAVV"
     MARIAIAHER WTDIAGSEQV TQQLTKTWSE TSVHVPFAKK SLIPEDLRDS FHISPLQVAY        60
     QLIRQRTYAP LLPLVPPAMQ WGSLRQAHDV DAVVVSHHAF ALAAVGAAQA INKPSVAYVH       120
     SPARWAWDAR FRQEEEHSRA GKAALSVLSA RARANETRWA PHVTSIMGNS SAVVKRIEQH       180
     WNREAQVVHP PVDTEFFHPD EAIEKGDYFI SVGRLVPYKQ VPLGVAAAVA AGVRLVVVGD       240
     GRDMDRARAF AGPNVEFKGR LPGDEMRDLI RGARALLMPG EEDFGIVPVE AMACGTPVIA       300
     LGKGGALDTV KPGISGELFS GDGEKEVIAN LAEVLKNFDD SRFNISTLRN WAEGFSEAAF       360
     REKMAEVVDA VV                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page